{"product_id":"proteintech-25597-1-ap","title":"Proteintech, 25597-1-AP, SLC10A5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC10A5 (25597-1-AP) by Proteintech is a Polyclonal antibody targeting SLC10A5 in IHC, ELISA applications with reactivity to human, mouse samples\n25597-1-AP targets SLC10A5 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSolute Carrier Family 10 Member 5 (SLC10A5) is a member of SLC10, comprising transporters of bile acids, steroidal hormones, and other substrates. SLC10A5 is involved in the uptake of bile acid, and its deficiency causes hypercholanemia(PMID: 38986003).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22339 Product name: Recombinant human SLC10A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-141 aa of BC136625 Sequence: ARMSSLSFLNIEKTEILFFTKTEETILVSSSYENKRPNSSHLFVKIEDPKILQMVNVAKKISSDATNFTINLVTDEEGETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHIDR Predict reactive species\nFull Name: solute carrier family 10 (sodium\/bile acid cotransporter family), member 5\nCalculated Molecular Weight: 438 aa, 49 kDa\nGenBank Accession Number: BC136625\nGene Symbol: SLC10A5\nGene ID (NCBI): 347051\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5PT55\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887803191465,"sku":"25597-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25597-1-ap","provider":"Iright","version":"1.0","type":"link"}