{"product_id":"proteintech-25607-1-ap","title":"Proteintech, 25607-1-AP, TOMM5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOMM5 (25607-1-AP) by Proteintech is a Polyclonal antibody targeting TOMM5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n25607-1-AP targets TOMM5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  HepG2 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTOMM5, also named as C9orf105 and TOM5, has three isoforms with MW 6 kDa and 9-10 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22275 Product name: Recombinant human TOMM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC034247 Sequence: MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI Predict reactive species\nFull Name: translocase of outer mitochondrial membrane 5 homolog (yeast)\nCalculated Molecular Weight: 51 aa, 6 kDa\nObserved Molecular Weight: 6-10 kDa\nGenBank Accession Number: BC034247\nGene Symbol: TOMM5\nGene ID (NCBI): 401505\nRRID: AB_2880157\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N4H5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869505048745,"sku":"25607-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25607-1-ap","provider":"Iright","version":"1.0","type":"link"}