{"product_id":"proteintech-25622-1-ap","title":"Proteintech, 25622-1-AP, BHLHE22 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BHLHE22 (25622-1-AP) by Proteintech is a Polyclonal antibody targeting BHLHE22 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human,  mouse samples\n25622-1-AP targets BHLHE22 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBasic helix-loop-helix family member e22 (BHLHE22), a basic helix loop helix transcription factor family member, acts as a transcriptional repressor and has a role in cell differentiation in neuron development (PMID: 36941015). BHLHE22 expression serves as a potential biomarker for ICI treatment prediction and favorable prognosis, and that is associated with microenvironment immune status (PMID: 35806162).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20966 Product name: Recombinant human BHLHE22 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-225 aa of BC156671 Sequence: MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSSPLGCFEPADPEGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGGGGSGSGSGG Predict reactive species\nFull Name: basic helix-loop-helix family, member e22\nCalculated Molecular Weight: 381 aa, 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC156671\nGene Symbol: BHLHE22\nGene ID (NCBI): 27319\nRRID: AB_2880165\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NFJ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869518254249,"sku":"25622-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25622-1-ap","provider":"Iright","version":"1.0","type":"link"}