{"product_id":"proteintech-25681-1-ap","title":"Proteintech, 25681-1-AP, SPTBN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPTBN1 (25681-1-AP) by Proteintech is a Polyclonal antibody targeting SPTBN1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n25681-1-AP targets SPTBN1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, mouse heart tissue,  HEK-293 cells,  SH-SY5Y cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPTBN1 is the non-erythrocytic form of β-spectrin or β-fodrin. Spectrins are members of the superfamily of F-actin cross linking proteins that are important as scaffolding proteins for protein sorting, cell adhesion, and migration. Reduced expression of SPTBN1 has been found to correlate with shorter survival of patients with hepatocellular cancer, pancreatic cancer and other malignancies of the gastrointestinal tract, suggesting tumor suppression ability of this protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22459 Product name: Recombinant human SPTBN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 633-820 aa of BC137282 Sequence: EMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKE Predict reactive species\nFull Name: spectrin, beta, non-erythrocytic 1\nCalculated Molecular Weight: 2364 aa, 275 kDa\nObserved Molecular Weight: 275 kDa\nGenBank Accession Number: BC137282\nGene Symbol: SPTBN1\nGene ID (NCBI): 6711\nRRID: AB_2880191\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01082\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869771223209,"sku":"25681-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25681-1-ap","provider":"Iright","version":"1.0","type":"link"}