{"product_id":"proteintech-25692-1-ap","title":"Proteintech, 25692-1-AP, BAIAP2L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAIAP2L1 (25692-1-AP) by Proteintech is a Polyclonal antibody targeting BAIAP2L1 in WB, IHC, ELISA applications with reactivity to human samples\n25692-1-AP targets BAIAP2L1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SGC-7901 cells,  K-562 cells\nPositive IHC detected in: human ovary tumor tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBAIAP2L1, also known as IRTKS, is a 511-amino acid protein containing an IRSp53\/MIM homology domain (IMD) that bundles actin filaments and interacts with the small GTPase Rac (PMID: 17430976; 14752106). In addition to the IMD domain, BAIAP2L1 also contains an SH3 domain and WW domain interaction motif. BAIAP2L1 is widely distributed and is an INS receptor substrate. It has a role in actin remodeling and membrane protrusion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22499 Product name: Recombinant human BAIAP2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-388 aa of BC013888 Sequence: DKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKA Predict reactive species\nFull Name: BAI1-associated protein 2-like 1\nCalculated Molecular Weight: 511 aa, 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC013888\nGene Symbol: BAIAP2L1\nGene ID (NCBI): 55971\nRRID: AB_2880197\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHR4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869641986217,"sku":"25692-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25692-1-ap","provider":"Iright","version":"1.0","type":"link"}