{"product_id":"proteintech-25699-1-ap","title":"Proteintech, 25699-1-AP, BDNF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BDNF (25699-1-AP) by Proteintech is a Polyclonal antibody targeting BDNF in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n25699-1-AP targets BDNF in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue\nPositive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue, mouse brain tissue\nPositive IF\/ICC detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\n1) What is BDNF?BDNF (brain-derived neurotrophic factor) is a small secreted growth factor that is important for the development and plasticity of the central nervous system and vital for long-term memory. Selected polymorphisms of BDNF have been shown to increase susceptibility to memory impairment and selected eating and mental disorders.2) FAQs for BDNFA) I can detect more than one band in my samplesBDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit, macaque\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22489 Product name: Recombinant human BDNF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-179 aa of BC029795 Sequence: SDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ Predict reactive species\nFull Name: brain-derived neurotrophic factor\nCalculated Molecular Weight: 247 aa, 28 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC029795\nGene Symbol: BDNF\nGene ID (NCBI): 627\nRRID: AB_3669493\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23560\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.\nFAQ\nA) I can detect more than one band in my samplesBDNF is a neurotrophin that is a subject of maturation by proteolytic cleavage. The precursor protein (pre-proBDNF) is first cleaved to proBDNF (~34 kDa) by removing a signal peptide, and then to a mature form of BDNF (14 kDa). Additionally, (pre-)proBDNF can form dimers that run between 50 and 60 kDa, and a minor truncated form of proBDNF running at 28 kDa has also been reported (PMID: 11152678).\nProtocolsProduct Specific ProtocolsIF protocol for BDNF antibody 25699-1-APDownload protocolIHC protocol for BDNF antibody 25699-1-APDownload protocolWB protocol for BDNF antibody 25699-1-APDownload protocolStandard ProtocolsClick here to view our Standard Protocols\nProtocolsProduct Specific ProtocolsIF protocol for BDNF antibody 25699-1-APDownload protocolIHC protocol for BDNF antibody 25699-1-APDownload protocolWB protocol for BDNF antibody 25699-1-APDownload protocolStandard ProtocolsClick here to view our Standard Protocols","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868837269673,"sku":"25699-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25699-1-ap","provider":"Iright","version":"1.0","type":"link"}