{"product_id":"proteintech-25708-1-ap","title":"Proteintech, 25708-1-AP, KK-LC-1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KK-LC-1 (25708-1-AP) by Proteintech is a Polyclonal antibody targeting KK-LC-1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25708-1-AP targets KK-LC-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human placenta tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKK-LC-1 has been described as kita-kyushu lung cancer antigen 1, cancer\/testis antigen 83. Therefore, KK-LC-1 is also known as CXorf61 and CT83. KK-LC-1 has been tested for association to diseases, such as adenocarcinoma and lung neoplasms. The molecular mass of KK-LC-1 is 13 kDa. Studies have shown that KK-LC-1 is an ideal target for immunotherapy of triple-negative breast cancer (TNBC) (PMID: 26327325).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22619 Product name: Recombinant human CXorf61 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-113 aa of BC062223 Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST Predict reactive species\nFull Name: chromosome X open reading frame 61\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC062223\nGene Symbol: KK-LC-1\nGene ID (NCBI): 203413\nRRID: AB_2880203\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5H943\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869468807337,"sku":"25708-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25708-1-ap","provider":"Iright","version":"1.0","type":"link"}