{"product_id":"proteintech-25717-1-ap","title":"Proteintech, 25717-1-AP, MAP6\/STOP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAP6\/STOP (25717-1-AP) by Proteintech is a Polyclonal antibody targeting MAP6\/STOP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n25717-1-AP targets MAP6\/STOP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse retina tissue, mouse brain tissue,  mouse cerebellum tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAP6, also named STOP protein, has been isolated from brain preparations but is also present in other tissues such as the skeletal muscles and heart.  MAP6 is a calmodulin-binding and calmodulin-regulated protein that is involved in microtubule stabilization. Different isoforms of STOP protein\narise from alternative mRNA splicing and transcription initiation sites using a single gene. The neuronal MAP6 isoforms N-STOP (120 kDa) and E-STOP (80 kDa), the astrocyte MAP6 isoform A-STOP (60 KDa), and a fibroblastic MAP6 isoform  F-STOP (48 kDa) have been identified.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22471 Product name: Recombinant human MAP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-484 aa of BC139780 Sequence: GQGPMVQEPLKKQGSVVPGPPKDLGPMIPLPVKDQDHTVPEPLKNESPVISAPVKDQGPSVPVPPKNQSPMVPAKVKDQGSVVPESLKDQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVSAPVKDQGPIVPAPVKGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDESAMATAPIKNQGSMVSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVAPVKNQGPVVPESVKNQDPILPVLVKDQGPTVLQPPKNQGRIVPEPLKNQVPIVPVPLKDQDPLVPVPAKDQGPAVPEPLKTQGPRDPQLPTVSPLPRVMIPTAPHTEYIESSP Predict reactive species\nFull Name: microtubule-associated protein 6\nCalculated Molecular Weight: 813 aa, 87 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC139780\nGene Symbol: MAP6\nGene ID (NCBI): 4135\nRRID: AB_3085819\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96JE9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887712948393,"sku":"25717-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25717-1-ap","provider":"Iright","version":"1.0","type":"link"}