{"product_id":"proteintech-25737-1-ap","title":"Proteintech, 25737-1-AP, ANKRD13B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKRD13B (25737-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD13B in WB, IHC, ELISA applications with reactivity to human,   mouse samples\n25737-1-AP targets ANKRD13B in WB, IHC, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse small intestine tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANKRD13B (ankyrin repeat domain 13B) is an ubiquitin-binding protein belongs to the Ankrd 13 family. It specifically recognizes and binds 'Lys-63'-linked ubiquitin, and positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane (PMID: 22298428). This antibody specifically recognises the 70 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22732 Product name: Recombinant human ANKRD13B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 433-493 aa of BC032554 Sequence: FGNLNGCDEPVPSVRGSPSSETPSPGSDSSSVSSSSSTTSCRGCEISPALFEAPRGYSMMG Predict reactive species\nFull Name: ankyrin repeat domain 13B\nCalculated Molecular Weight: 626 aa, 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC032554\nGene Symbol: ANKRD13B\nGene ID (NCBI): 124930\nRRID: AB_2880217\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86YJ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884970332329,"sku":"25737-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25737-1-ap","provider":"Iright","version":"1.0","type":"link"}