{"product_id":"proteintech-25738-1-ap","title":"Proteintech, 25738-1-AP, ANKRD54 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKRD54 (25738-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD54 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n25738-1-AP targets ANKRD54 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  K-562 cells,  PC-3 cells\nPositive IHC detected in: mouse testis tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22759 Product name: Recombinant human ANKRD54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-300 aa of BC066909 Sequence: RVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR Predict reactive species\nFull Name: ankyrin repeat domain 54\nCalculated Molecular Weight: 300 aa, 33 kDa\nObserved Molecular Weight: 33-35 kDa\nGenBank Accession Number: BC066909\nGene Symbol: ANKRD54\nGene ID (NCBI): 129138\nRRID: AB_2880218\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6NXT1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884970725545,"sku":"25738-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25738-1-ap","provider":"Iright","version":"1.0","type":"link"}