{"product_id":"proteintech-25752-1-ap","title":"Proteintech, 25752-1-AP, COX20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX20 (25752-1-AP) by Proteintech is a Polyclonal antibody targeting COX20 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n25752-1-AP targets COX20 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells\nPositive IHC detected in: human prostate cancer tissue,  human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX20, also name as FAM36A, belongs to the COX20 family. Mutations in COX20 are a novel cause of recessively inherited.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22520 Product name: Recombinant human FAM36A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-118 aa of BC018519 Sequence: MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN Predict reactive species\nFull Name: family with sequence similarity 36, member A\nCalculated Molecular Weight: 118 aa, 13 kDa\nObserved Molecular Weight: ~16 kDa\nGenBank Accession Number: BC018519\nGene Symbol: COX20\nGene ID (NCBI): 116228\nRRID: AB_2880224\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5RI15\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868995899561,"sku":"25752-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25752-1-ap","provider":"Iright","version":"1.0","type":"link"}