{"product_id":"proteintech-25825-1-ap","title":"Proteintech, 25825-1-AP, VSX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VSX2 (25825-1-AP) by Proteintech is a Polyclonal antibody targeting VSX2 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse samples\n25825-1-AP targets VSX2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue\nPositive IHC detected in: human retinoblastoma tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse eye tissue\nPositive IF-Fro detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23035 Product name: Recombinant human VSX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC128153 Sequence: MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRK Predict reactive species\nFull Name: visual system homeobox 2\nCalculated Molecular Weight: 361 aa, 39 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC128153\nGene Symbol: VSX2\nGene ID (NCBI): 338917\nRRID: AB_2880257\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P58304\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869508980905,"sku":"25825-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25825-1-ap","provider":"Iright","version":"1.0","type":"link"}