{"product_id":"proteintech-25835-1-ap","title":"Proteintech, 25835-1-AP, DGCR8 N-terminal Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DGCR8 N-terminal (25835-1-AP) by Proteintech is a Polyclonal antibody targeting DGCR8 N-terminal in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n25835-1-AP targets DGCR8 N-terminal in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  A431 cells\nPositive IP detected in: A431 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDGCR8 is a RNA-binding protein that assists the Rnase III enzyme Drosha in the processing of microRNAs (miRNAs), which regulate the expression of a large number of protein-coding genes[PMID: 22580560]. DGCR8, which contains two double-stranded RNA (dsRNA)-binding domains, may be an essential component of the primary miRNAs processing complex, along with Drosha, promoting the processing of primary microRNA to precursor microRNA. It is ubiquitous expressed in human and mouse tissues, and is deleted in DiGeorge syndrome[22323604]. The calculated molecular weight of DGCR8 is  82-86 kDa, but the post-modified DGCR8 is about 120 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22988 Product name: Recombinant human DGCR8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC078147 Sequence: METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPTEPL Predict reactive species\nFull Name: DiGeorge syndrome critical region gene 8\nCalculated Molecular Weight: 773 aa, 86 kDa\nObserved Molecular Weight: 88-100 kDa\nGenBank Accession Number: BC078147\nGene Symbol: DGCR8\nGene ID (NCBI): 54487\nRRID: AB_2880262\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WYQ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869530509481,"sku":"25835-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25835-1-ap","provider":"Iright","version":"1.0","type":"link"}