{"product_id":"proteintech-25845-1-ap","title":"Proteintech, 25845-1-AP, SUDS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUDS3 (25845-1-AP) by Proteintech is a Polyclonal antibody targeting SUDS3 in WB, ELISA applications with reactivity to human samples\n25845-1-AP targets SUDS3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells,  HL-60 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSUDS3 (Sin3 histone deacetylase corepressor complex component SDS3), also known as SAP45 andSDS3, is a component of the Sin3 histone deacetylase corepressor complex. In this complex SDS3 interacts with SIN3A to regulate gene expression via chromatin modification. SUDS3 represses transcription and augments histone deacetylase activity of HDAC1. It may have a potential role in tumor suppressor pathways through regulation of apoptosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22961 Product name: Recombinant human SUDS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC112000 Sequence: ELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPASPSSPEHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVRKTSDSTKMRIYLGQLQRGLFVIRRRSAA Predict reactive species\nFull Name: suppressor of defective silencing 3 homolog (S. cerevisiae)\nCalculated Molecular Weight: 328 aa, 38 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC112000\nGene Symbol: SUDS3\nGene ID (NCBI): 64426\nRRID: AB_2880265\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H7L9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887819215017,"sku":"25845-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25845-1-ap","provider":"Iright","version":"1.0","type":"link"}