{"product_id":"proteintech-25857-1-ap","title":"Proteintech, 25857-1-AP, SAC3D1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SAC3D1 (25857-1-AP) by Proteintech is a Polyclonal antibody targeting SAC3D1 in WB, IHC, ELISA applications with reactivity to human samples\n25857-1-AP targets SAC3D1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HeLa cells,  PC-3 cells,  HeLa  cells\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSAC3D1, also named as SHD1 and HSU79266. SAC3D1 is widely found in the cytoplasm, cytoskeleton, microtubule, tissue center, centrosome and spindle, involved in centrosome duplication and mitotic progression. SAC3D1 is abnormally expressed in multiple types of cancer, such as colon cancer and hepatocellular carcinoma and gastric cancer. SAC3D1 may serve as a prognostic biomarker in hepatocellular carcinoma (PMID: 30353105, 32319600). SAC3D1 has 2 isoforms with the molecular mass of 44 and 31 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23026 Product name: Recombinant human SAC3D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-404 aa of BC007448 Sequence: VKEYSRPAAGKPRPPPSQLRPPSVLLATVRYLAGEVAESADIARAEVASFVADRLRAVRLDLALQGAGDAEAAVVLEAALATLLAVVARLGPDAARGPADPVLLQAQVQEGFGSLRRCYARGAGPHPRQPAFQGLFLLYNLGSVEALHEVLQLPAALRACPPLRKALAVDAAFREGNAARLFRLLQTLPYLPSCAVQCHVGHARREALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGEERVVFLRGRYVEEGLPPASTCKVLVESKLRGRTLEEVVMAEEEDEGTDRPGSPA Predict reactive species\nFull Name: SAC3 domain containing 1\nCalculated Molecular Weight: 404 aa, 44 kDa\nObserved Molecular Weight: 44, 31 kDa\nGenBank Accession Number: BC007448\nGene Symbol: SAC3D1\nGene ID (NCBI): 29901\nRRID: AB_2918096\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: F8WC89\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869496070313,"sku":"25857-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25857-1-ap","provider":"Iright","version":"1.0","type":"link"}