{"product_id":"proteintech-25865-1-ap","title":"Proteintech, 25865-1-AP, PIM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PIM2 (25865-1-AP) by Proteintech is a Polyclonal antibody targeting PIM2 in IP, IHC, ELISA applications with reactivity to human, mouse samples\n25865-1-AP targets PIM2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: Raji cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPIM2 was first identified in T and B cell lymphomas in mice and is a member of a serine\/threonine kinase family of proto-oncogenes, which also includes PIM1 and PIM3 (PMID:24505470). They share high sequence homology at the amino acid level; PIM1 and PIM2 are 61% identical and PIM1 and PIM3 are 71% identical (PMID:34503111). The PIM2 protein plays an important role in promoting cell survival and preventing apoptosis. PIM2 is mainly expressed in lymphoid and brain tissues. In human cells, the PIM2 kinase has only two isoforms (34 and 41 kDa), but in mice there are there (34, 37, and 40 kDa), and the 34 kDa isoform has been the main focus of many studies because it plays a crucial role in tumor progression (PMID:33854618).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23130 Product name: Recombinant human PIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-311 aa of BC018111 Sequence: RDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKGGPAPLAWSLLP Predict reactive species\nFull Name: pim-2 oncogene\nCalculated Molecular Weight: 311 aa, 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC018111\nGene Symbol: PIM2\nGene ID (NCBI): 11040\nRRID: AB_2880275\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P1W9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869572452521,"sku":"25865-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25865-1-ap","provider":"Iright","version":"1.0","type":"link"}