{"product_id":"proteintech-25869-1-ap","title":"Proteintech, 25869-1-AP, c-Met (Cytoplasmic) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe c-Met (Cytoplasmic) (25869-1-AP) by Proteintech is a Polyclonal antibody targeting c-Met (Cytoplasmic) in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, canine samples\n25869-1-AP targets c-Met (Cytoplasmic) in WB, IHC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MDCK cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissue,  human colon tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nc-Met (also named MET or HGFR) is a receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to the HGF ligand. c-Met regulates many physiological processes including proliferation, scattering, morphogenesis, and survival. The primary single-chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide-linked to form the mature receptor. Overexpression and\/or mutation of c-Met has been reported in various human malignancies, including lung cancer, breast cancer, head and neck cancer, gastric cancer, colorectal cancer, bladder cancer, uterine cervix carcinoma, esophageal carcinoma, c-Met could serve as an important therapeutic target (PMID: 26036285). The c-met receptor is a 190-kD glycoprotein consisting of a 145-kD membrane-spanning beta chain and a 50-kD alpha chain (PMID: 7806559). In Western blot, this antibody produces bands of unknown identity at 55 and 100 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, canine\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23140 Product name: Recombinant human MET protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 965-1085 aa of BC130420 Sequence: GSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIG Predict reactive species\nFull Name: met proto-oncogene (hepatocyte growth factor receptor)\nCalculated Molecular Weight: 1390 aa, 155 kDa\nObserved Molecular Weight: 145 kDa\nGenBank Accession Number: BC130420\nGene Symbol: MET\nGene ID (NCBI): 4233\nRRID: AB_2880276\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08581\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868836712617,"sku":"25869-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25869-1-ap","provider":"Iright","version":"1.0","type":"link"}