{"product_id":"proteintech-25876-1-ap","title":"Proteintech, 25876-1-AP, Alpha-1-antitrypsin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Alpha-1-antitrypsin (25876-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha-1-antitrypsin in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n25876-1-AP targets Alpha-1-antitrypsin in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva, human urine\nPositive IP detected in: human plasma\nPositive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSERPINA1 is the gene for a protein called alpha-1-antitrypsin (AAT), which is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. AAT is a glycoprotein synthesized primarily by hepatocytes, with smaller amountssynthesized by intestinal epithelial cells, neutrophils, pulmonary alveolar cells and macrophages. AAT is the most abundant, endogenous serine protease inhibitor in blood circulation and it has been implicated in regulating vital fluid phase biological events such as blood coagulation, fibrinolysis, complement activation, apoptosis, reproduction, tumor progression and inflammatory response. The primary function of AAT is thought to be the inactivation of neutrophil elastase and other endogenous serine proteases. Defects in SERPINA1 can cause emphysema or liver disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22631 Product name: Recombinant human a1-antitrypsin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-327 aa of BC011991 Sequence: EVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVL Predict reactive species\nFull Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1\nObserved Molecular Weight: 47-50 kDa\nGenBank Accession Number: BC011991\nGene Symbol: Alpha 1-Antitrypsin\nGene ID (NCBI): 5265\nRRID: AB_3669504\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01009\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869807890601,"sku":"25876-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25876-1-ap","provider":"Iright","version":"1.0","type":"link"}