{"product_id":"proteintech-25913-1-ap","title":"Proteintech, 25913-1-AP, TRIM36 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM36 (25913-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM36 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n25913-1-AP targets TRIM36 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM36, a member of the tripartite motif (TRIM) family of RING-containing proteins, also known as Haprin, is a microtubule-associated E3 ubiquitin ligase that plays a role in cytoskeletal organization, which was first discovered for its abundance in testis and found to be implicated in the spermatozoa acrosome reaction (PMID: 35053362, 30944633). TRIM36 was reported as a novel androgen signaling target gene and is upregulated in prostate cancer (PMID: 29449534).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23240 Product name: Recombinant human TRIM36 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-215 aa of BC130334 Sequence: ESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEH Predict reactive species\nFull Name: tripartite motif-containing 36\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: BC130334\nGene Symbol: TRIM36\nGene ID (NCBI): 55521\nRRID: AB_2880293\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQ86\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887838515369,"sku":"25913-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25913-1-ap","provider":"Iright","version":"1.0","type":"link"}