{"product_id":"proteintech-25928-1-ap","title":"Proteintech, 25928-1-AP, SNAT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNAT2 (25928-1-AP) by Proteintech is a Polyclonal antibody targeting SNAT2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n25928-1-AP targets SNAT2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated mouse brain tissue\nPositive IHC detected in: mouse pancreas tissue, human cervical cancer tissue,  human kidney tissue,  rat pancreas tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSNAT2 (Sodium-dependent neutral amino acid transporter-2), the ubiquitous member of SLC38 family, accounts for the activity of transport system A for neutral amino acids in most mammalian tissues (PMID: 16734764). SNAT2 mediates uptake of neutral α-amino acids and are expressed in central neurons (PMID: 19240036). SNAT2 is expressed in breast cancer cell lines. SLC38A2 also acts as a selective target for inhibiting growth of Gln-dependent breast cancer cell lines (PMID: 33028955).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23082 Product name: Recombinant human SLC38A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC040342 Sequence: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQN Predict reactive species\nFull Name: solute carrier family 38, member 2\nObserved Molecular Weight: 45 kDa, 56 kDa\nGenBank Accession Number: BC040342\nGene Symbol: SLC38A2\nGene ID (NCBI): 54407\nRRID: AB_3085830\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96QD8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869768470697,"sku":"25928-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25928-1-ap","provider":"Iright","version":"1.0","type":"link"}