{"product_id":"proteintech-25977-1-ap","title":"Proteintech, 25977-1-AP, NRAP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NRAP (25977-1-AP) by Proteintech is a Polyclonal antibody targeting NRAP in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n25977-1-AP targets NRAP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse skeletal muscle tissue,  rat heart tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNRAP (Nebulin-related-anchoring protein) is a striated muscle-specific protein that is concentrated at intercalated disks in cardiac muscle and at myotendinous junctions in skeletal muscle. NRAP is a 197 kDa multidomain scaffolding protein from nebulin family with many interation partners such as α-actinin, actin, vinculin and filamin (PMID:21276443). During cardiomyocyte development in the foetal heart, NRAP is involved in myofibrillar assembly and links terminal actin filaments to membrane complexes in the adult heart. Several studies observed that NRAP mutation would contributed to the dilated cardiomyopathy which is a highly heterogeneous disease with almost 100 candidates genes to date (PMID:28611399).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23254 Product name: Recombinant human NRAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1309-1393 aa of BC126407 Sequence: RHDFVKERGKLIGPQSVRDDPRIQHCRRMGQLQSELQYRRGATSSQAQFHLPMDMVHLVHAKNAQALASDHDYRTQYHKFTALPE Predict reactive species\nFull Name: nebulin-related anchoring protein\nObserved Molecular Weight: 190-200 kDa\nGenBank Accession Number: BC126407\nGene Symbol: NRAP\nGene ID (NCBI): 4892\nRRID: AB_2918098\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86VF7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887742013609,"sku":"25977-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25977-1-ap","provider":"Iright","version":"1.0","type":"link"}