{"product_id":"proteintech-25996-1-ap","title":"Proteintech, 25996-1-AP, GPR148 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR148 (25996-1-AP) by Proteintech is a Polyclonal antibody targeting GPR148 in IHC, ELISA applications with reactivity to human, mouse samples\n25996-1-AP targets GPR148 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR148, also known as BTR or PGR6, belongs to a G protein-coupled receptor (GPCR) family. It is primarily expressed in the brain and testis, suggesting a role in specific sensory functions and possibly in reproductive processes. As a GPCR, GPR148 is likely to be involved in signal transduction pathways triggered by the binding of specific ligands, such as odorants or other small molecules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22948 Product name: Recombinant human GPR148 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC105013 Sequence: MGDELAPCPVGTTAWPALIQLISKTPCMPQAASNTSLGLGDLRVPSSMLYWLFLPSSLLAAATLAVSPLLLVTILRNQRLRQEPHYLLPANILLS Predict reactive species\nFull Name: G protein-coupled receptor 148\nCalculated Molecular Weight: 347 aa, 38 kDa\nGenBank Accession Number: BC105013\nGene Symbol: GPR148\nGene ID (NCBI): 344561\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDV2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887656259753,"sku":"25996-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25996-1-ap","provider":"Iright","version":"1.0","type":"link"}