{"product_id":"proteintech-26001-1-ap","title":"Proteintech, 26001-1-AP, SRD5A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRD5A1 (26001-1-AP) by Proteintech is a Polyclonal antibody targeting SRD5A1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26001-1-AP targets SRD5A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  DU 145 cells\nPositive IHC detected in: human colon cancer tissue, human prostate cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSteroid 5-alpha-reductase (SRD5A1) catalyzes the conversion of 17β-Hydroxyandrost-4-en-3-one into the more potent androgen, DHT. SRD5A1 is a minor component of the reductase activity in prostate although the gene was originally cloned from prostate. On the other hand, SRD5A1 appears to be the predominant isozyme of steroid 5-alpha-reductase in the scalp and elsewhere in the skin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23351 Product name: Recombinant human SRD5A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-163 aa of BC007033 Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGML Predict reactive species\nFull Name: steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC007033\nGene Symbol: SRD5A1\nGene ID (NCBI): 6715\nRRID: AB_2880328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18405\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961001641,"sku":"26001-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26001-1-ap","provider":"Iright","version":"1.0","type":"link"}