{"product_id":"proteintech-26015-1-ap","title":"Proteintech, 26015-1-AP, RNF128 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF128 (26015-1-AP) by Proteintech is a Polyclonal antibody targeting RNF128 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26015-1-AP targets RNF128 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22834 Product name: Recombinant human RNF128 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 333-428 aa of BC063404 Sequence: DGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREIKS Predict reactive species\nFull Name: ring finger protein 128\nCalculated Molecular Weight: 428 aa, 47 kDa\nObserved Molecular Weight: 40-47 kDa, 66-70 kDa\nGenBank Accession Number: BC063404\nGene Symbol: RNF128\nGene ID (NCBI): 79589\nRRID: AB_2880336\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TEB7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869755986089,"sku":"26015-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26015-1-ap","provider":"Iright","version":"1.0","type":"link"}