{"product_id":"proteintech-26023-1-ap","title":"Proteintech, 26023-1-AP, ZCCHC13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZCCHC13 (26023-1-AP) by Proteintech is a Polyclonal antibody targeting ZCCHC13 in WB, ELISA applications with reactivity to human,  mouse,  rat samples\n26023-1-AP targets ZCCHC13 in WB, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-3 cells,  HepG2 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZCCHC13 (zinc-finger CCHC-type containing 13) is a member of a family of zinc-finger CCHC-type containing DNA\/RNA-binding proteins that are involved in mRNA transcription and protein translation. Downregulation of ZCCHC13 was shown to be associated with spermatogenesis failure in patients with non-obstructive azoospermia (NOA)(PMID: 29531833). It is reported that ZCCHC13 overexpression might be related to global DNA hypomethylation and promote hepatocellular carcinoma (HCC)(PMID: 23891108).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22050 Product name: Recombinant human ZCCHC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC021176 Sequence: MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNI Predict reactive species\nFull Name: zinc finger, CCHC domain containing 13\nCalculated Molecular Weight: 166 aa, 18 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC021176\nGene Symbol: ZCCHC13\nGene ID (NCBI): 389874\nRRID: AB_3669517\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WW36\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887927578793,"sku":"26023-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26023-1-ap","provider":"Iright","version":"1.0","type":"link"}