{"product_id":"proteintech-26025-1-ap","title":"Proteintech, 26025-1-AP, CHRNA9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHRNA9 (26025-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNA9 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26025-1-AP targets CHRNA9 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue\nPositive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23272 Product name: Recombinant human CHRNA9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 324-479 aa of BC113549 Sequence: HFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQYKVLTRNIEYIAKCLKDHKATSSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD Predict reactive species\nFull Name: cholinergic receptor, nicotinic, alpha 9\nCalculated Molecular Weight: 479 aa, 55 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC113549\nGene Symbol: CHRNA9\nGene ID (NCBI): 55584\nRRID: AB_2880341\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UGM1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869524840617,"sku":"26025-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26025-1-ap","provider":"Iright","version":"1.0","type":"link"}