{"product_id":"proteintech-26029-1-ap","title":"Proteintech, 26029-1-AP, C2orf3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C2orf3 (26029-1-AP) by Proteintech is a Polyclonal antibody targeting C2orf3 in WB, ELISA applications with reactivity to human samples\n26029-1-AP targets C2orf3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells,  HeLa cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGC-rich sequence DNA-binding factor is a protein that in humans is encoded by the C2orf3 gene. C2orf3 belongs to the GCF family. It is a factor that represses transcription. It binds to the GC-rich sequences present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters. The MW of this protein is 89 kDa, and this antibody specially recognises the 89 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23315 Product name: Recombinant human C2orf3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC064559 Sequence: MAHRPKRTFRQRAADSSDSDGAEESPAEPGAARELPVPGSAEEEPPSGGGRAQVAGLPHRVRGPRGRGRVWASSRRATKAAPRADEGSESRTLDVSTDEEDKIHHSSESKDDQGLSSDSSSSLGEKELSSTVK Predict reactive species\nFull Name: chromosome 2 open reading frame 3\nObserved Molecular Weight: 89 kDa\nGenBank Accession Number: BC064559\nGene Symbol: C2orf3\nGene ID (NCBI): 6936\nRRID: AB_2880343\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16383\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885581684905,"sku":"26029-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26029-1-ap","provider":"Iright","version":"1.0","type":"link"}