{"product_id":"proteintech-26045-1-ap","title":"Proteintech, 26045-1-AP, Serpin F1\/PEDF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Serpin F1\/PEDF (26045-1-AP) by Proteintech is a Polyclonal antibody targeting Serpin F1\/PEDF in WB, IHC, ELISA applications with reactivity to human samples\n26045-1-AP targets Serpin F1\/PEDF in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, human serum\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPEDF also known as serpin F1 (SERPINF1), is a multifunctional secreted protein that has anti-angiogenic, anti-tumorigenic, and neurotrophic functionsis. It is an approximately 50-kDa secreted protein that is widely expressed, including by osteoblasts and osteoclasts. PEDF is also one of the most abundant secretory products of adipocytes, and circulating concentrations of PEDF correlate positively with body fat mass and INS resistance. PEDF is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells. Mutations in this gene were found in individuals with osteogenesis imperfecta, type VI.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23296 Product name: Recombinant human SERPINF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 87-418 aa of BC013984 Sequence: TALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTARQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP Predict reactive species\nFull Name: serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1\nCalculated Molecular Weight: 418 aa, 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC013984\nGene Symbol: PEDF\nGene ID (NCBI): 5176\nRRID: AB_2880349\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36955\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869429616809,"sku":"26045-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26045-1-ap","provider":"Iright","version":"1.0","type":"link"}