{"product_id":"proteintech-26048-1-ap","title":"Proteintech, 26048-1-AP, IL-1 beta Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-1 beta (26048-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1 beta in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26048-1-AP targets IL-1 beta in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, LPS and Brefeldin A treated NR8383 cells,  LPS and Brefeldin A treated THP-1 cells\nPositive IF\/ICC detected in: PMA, LPS and Brefeldin A treated THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit, monkey, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23461 Product name: Recombinant mouse IL-1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-269 aa of NM_008361 Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Predict reactive species\nFull Name: interleukin 1 beta\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: NM_008361\nGene Symbol: IL-1 beta\nGene ID (NCBI): 16176\nRRID: AB_2880351\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10749\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868822524073,"sku":"26048-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26048-1-ap","provider":"Iright","version":"1.0","type":"link"}