{"product_id":"proteintech-26060-1-ap","title":"Proteintech, 26060-1-AP, SLFN11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLFN11 (26060-1-AP) by Proteintech is a Polyclonal antibody targeting SLFN11 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n26060-1-AP targets SLFN11 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, HEK-293 cells,  Jurkat cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22030 Product name: Recombinant human SLFN11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 735-796 aa of BC052586 Sequence: DPIAKYLQKEMQVIRSNPSFNIPTGCLEVFPEAEWSQGVQGTLRIKKYLTVEQIMTCVADTC Predict reactive species\nFull Name: schlafen family member 11\nCalculated Molecular Weight: 901 aa, 103 kDa\nObserved Molecular Weight: 103 kDa\nGenBank Accession Number: BC052586\nGene Symbol: SLFN11\nGene ID (NCBI): 91607\nRRID: AB_2880356\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z7L1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869767454889,"sku":"26060-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26060-1-ap","provider":"Iright","version":"1.0","type":"link"}