{"product_id":"proteintech-26069-1-ap","title":"Proteintech, 26069-1-AP, UBR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBR1 (26069-1-AP) by Proteintech is a Polyclonal antibody targeting UBR1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n26069-1-AP targets UBR1 in WB, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BGC-823 cells, mouse skeletal muscle tissue,  rat skeletal muscle tissue\nPositive IP detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22076 Product name: Recombinant human UBR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC113505 Sequence: MADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQL Predict reactive species\nFull Name: ubiquitin protein ligase E3 component n-recognin 1\nCalculated Molecular Weight: 1749 aa, 200 kDa\nObserved Molecular Weight: 200 kDa\nGenBank Accession Number: BC113505\nGene Symbol: UBR1\nGene ID (NCBI): 197131\nRRID: AB_2880360\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWV7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869389312169,"sku":"26069-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26069-1-ap","provider":"Iright","version":"1.0","type":"link"}