{"product_id":"proteintech-26077-1-ap","title":"Proteintech, 26077-1-AP, CLEC12B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLEC12B (26077-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC12B in WB, ELISA applications with reactivity to human,  mouse,  rat samples\n26077-1-AP targets CLEC12B in WB, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  K-562 cells,  mouse spleen tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLEC12B (C-type lectin domain family 12 member B) is a single-pass type II membrane protein of the C-type lectin-like family. CLEC12B acts as an inhibitory receptor on myeloid cells. CLEC12B may be involved in limiting the activity of monocyte-derived immune cells after cell differentiation and possibly during inflammatory diseases. (PMID: 17562706)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23396 Product name: Recombinant human CLEC12B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 65-232 aa of BC136805 Sequence: LQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSLLKRQEQMAIKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLYVSNY Predict reactive species\nFull Name: C-type lectin domain family 12, member B\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC136805\nGene Symbol: CLEC12B\nGene ID (NCBI): 387837\nRRID: AB_2880365\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q2HXU8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886601785513,"sku":"26077-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26077-1-ap","provider":"Iright","version":"1.0","type":"link"}