{"product_id":"proteintech-26086-1-ap","title":"Proteintech, 26086-1-AP, C16orf61 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C16orf61 (26086-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf61 in WB, ELISA applications with reactivity to human samples\n26086-1-AP targets C16orf61 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells,  human kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe function of C16orf61 remains largely unknown. It may be involved in cytochrome c oxidase biogenesis. Catalog#26086-1-AP is a rabbit polyclonal antibody raised against the full-length of human C16orf61. The MW of this protein is 9 kDa, and this antibody specially recognises the 9 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23319 Product name: Recombinant human C16orf61 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC032631 Sequence: MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESEK Predict reactive species\nFull Name: chromosome 16 open reading frame 61\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC032631\nGene Symbol: C16orf61\nGene ID (NCBI): 56942\nRRID: AB_2880369\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRP2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885469814953,"sku":"26086-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26086-1-ap","provider":"Iright","version":"1.0","type":"link"}