{"product_id":"proteintech-26127-1-ap","title":"Proteintech, 26127-1-AP, C9orf80 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C9orf80 (26127-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf80 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n26127-1-AP targets C9orf80 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC9orf80 (INIP) is also a nuclear protein related to protein synthesis and transportation. C9orf80 is a member of the core hSSB1 complex, which plays an important role in DNA damage response and genome stability maintenance(PMID: 23986477).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23582 Product name: Recombinant human C9orf80 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC014881 Sequence: MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE Predict reactive species\nFull Name: chromosome 9 open reading frame 80\nGenBank Accession Number: BC014881\nGene Symbol: C9orf80\nGene ID (NCBI): 58493\nRRID: AB_3669523\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRY2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885711282345,"sku":"26127-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26127-1-ap","provider":"Iright","version":"1.0","type":"link"}