{"product_id":"proteintech-26131-1-ap","title":"Proteintech, 26131-1-AP, MPIG6B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MPIG6B (26131-1-AP) by Proteintech is a Polyclonal antibody targeting MPIG6B in WB, ELISA applications with reactivity to human samples\n26131-1-AP targets MPIG6B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human peripheral blood platelets\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC6orf25, also called G6B, is an inhibitory receptor expressed on the surface of platelets,and it acts as a critical regulator of hematopoietic lineage differentiation, megakaryocyte function and platelet production (PMID: 17311996; 12665801; 27743390). C6orf25 has seven isoforms. Isoform B is the only isoform to contain both a transmembrane region and 2 immunoreceptor tyrosine-based inhibitor motifs (ITIMs) and, thus, the only one which probably has a role of inhibitory receptor. Isoform A may be the activating counterpart of isoform B (PMID: 11544253).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23442 Product name: Recombinant human C6orf25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC113719 Sequence: MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKA Predict reactive species\nFull Name: chromosome 6 open reading frame 25\nObserved Molecular Weight: 24-29 kDa\nGenBank Accession Number: BC113719\nGene Symbol: C6orf25\nGene ID (NCBI): 80739\nRRID: AB_3669524\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95866\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887723106473,"sku":"26131-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26131-1-ap","provider":"Iright","version":"1.0","type":"link"}