{"product_id":"proteintech-26132-1-ap","title":"Proteintech, 26132-1-AP, RGS11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RGS11 (26132-1-AP) by Proteintech is a Polyclonal antibody targeting RGS11 in WB, IHC, ELISA applications with reactivity to human,  rat,  mouse samples\n26132-1-AP targets RGS11 in WB, IHC, ELISA applications and shows reactivity with human,  rat,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells,  rat brain tissue\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23562 Product name: Recombinant human RGS11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-102 aa of BC153019 Sequence: MERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEEEALHLGAVLVQHGYIYPLRDPRSLMLRPDETP Predict reactive species\nFull Name: regulator of G-protein signaling 11\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC153019\nGene Symbol: RGS11\nGene ID (NCBI): 8786\nRRID: AB_2880394\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94810\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887783891113,"sku":"26132-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26132-1-ap","provider":"Iright","version":"1.0","type":"link"}