{"product_id":"proteintech-26144-1-ap","title":"Proteintech, 26144-1-AP, RNF144A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF144A (26144-1-AP) by Proteintech is a Polyclonal antibody targeting RNF144A in WB, IP, ELISA applications with reactivity to human, hamster samples\n26144-1-AP targets RNF144A in WB, IP, ELISA applications and shows reactivity with human, hamster samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells\nPositive IP detected in: CHO cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNF144A (Ring Finger protein 144A) as the first E3 ubiquitin ligase for cytosolic DNA-PKcs, is induced in a p53-dependent manner during DNA damage and targets cytosolic DNA-PKcs for ubiquitination and degradation. RNF144A is an RBR-containing protein, and is unstable and degraded through the proteasome-dependent pathway (PMID: 24979766). RNF144A contains an RBR domain in the N-terminus and a potential single-transmembrane (TM) domain in the C-terminus, and is distributed in both plasma membrane and the membranes of intracellular vesicles\nincluding endosomes, lysosomes, endoplasmic reticulum (ER), perinuclear vesicles, and others, which might be caused by the presence of the TM domain (PMID: 37955227).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, hamster\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23508 Product name: Recombinant human RNF144A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-179 aa of BC050373 Sequence: ELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDD Predict reactive species\nFull Name: ring finger protein 144A\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC050373\nGene Symbol: RNF144A\nGene ID (NCBI): 9781\nRRID: AB_2880402\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50876\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869587722409,"sku":"26144-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26144-1-ap","provider":"Iright","version":"1.0","type":"link"}