{"product_id":"proteintech-26151-1-ap","title":"Proteintech, 26151-1-AP, MYEOV2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYEOV2 (26151-1-AP) by Proteintech is a Polyclonal antibody targeting MYEOV2 in WB, ELISA applications with reactivity to human samples\n26151-1-AP targets MYEOV2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYEOV2, also known as Myeloma-overexpressed gene 2 protein, is a low abundance protein. The function of MYEOV2 remains largely unknown. MYEOV2 has 2 isoforms with MW 27 kDa and 6 kDa according to UniProt. Catalog#26151-1-AP specially recognises the 27 kDa isoform.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23560 Product name: Recombinant human MYEOV2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC033955 Sequence: MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ Predict reactive species\nFull Name: myeloma overexpressed 2\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC033955\nGene Symbol: MYEOV2\nGene ID (NCBI): 150678\nRRID: AB_2880405\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WXC6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887729987753,"sku":"26151-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26151-1-ap","provider":"Iright","version":"1.0","type":"link"}