{"product_id":"proteintech-26163-1-ap","title":"Proteintech, 26163-1-AP, IL-17a Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-17a (26163-1-AP) by Proteintech is a Polyclonal antibody targeting IL-17a in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n26163-1-AP targets IL-17a in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PMA, Ionomycin and Brefeldin A treated EL-4 cells\nPositive IHC detected in: mouse spleen tissue, human liver cancer tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe IL17A monomer is a peptide consisting of 155 amino acids. The IL17A peptide comprises a 23 amino acid signal peptide and a 132 amino acid mature peptide. The IL17A homodimer has a molecular weight of 35 kD  (Kolls and Lindén, 2004).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24087 Product name: Recombinant mouse IL-17A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-158 aa of NM-010552 Sequence: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Predict reactive species\nFull Name: interleukin 17A\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 15kDa,17 kDa\nGenBank Accession Number: NM-010552\nGene Symbol: Il17a\nGene ID (NCBI): 16171\nRRID: AB_2880409\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q62386\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868851622057,"sku":"26163-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26163-1-ap","provider":"Iright","version":"1.0","type":"link"}