{"product_id":"proteintech-26187-1-ap","title":"Proteintech, 26187-1-AP, DRP1 (N-terminal) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DRP1 (N-terminal) (26187-1-AP) by Proteintech is a Polyclonal antibody targeting DRP1 (N-terminal) in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n26187-1-AP targets DRP1 (N-terminal) in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNM1L(Dynamin-1-like protein) , also known as dynamin-related protein 1 (DRP1), belongs to the dynamin family of large GTPases that mediate membrane remodeling during a variety of cellular processes. DNM1L has an important role in the division of growing mitochondria and peroxisomes and also mediates outer mitochondrial membrane fission in mammalian cells. DNM1L is ubiquitously expressed with abundant expression in skeletal muscle, heart, kidney and brain.Variable isoforms of DNM1L have been reported in a tissue-specific manner due to the alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24249 Product name: Recombinant human DNM1L,DLP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 69-142 aa of BC024590 Sequence: HVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNL Predict reactive species\nFull Name: dynamin 1-like\nCalculated Molecular Weight: 736 aa, 82 kDa\nObserved Molecular Weight: 70-78 kDa\nGenBank Accession Number: BC024590\nGene Symbol: DRP1\nGene ID (NCBI): 10059\nRRID: AB_2880417\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00429\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868965359785,"sku":"26187-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26187-1-ap","provider":"Iright","version":"1.0","type":"link"}