{"product_id":"proteintech-26203-1-ap","title":"Proteintech, 26203-1-AP, NDST1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDST1 (26203-1-AP) by Proteintech is a Polyclonal antibody targeting NDST1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n26203-1-AP targets NDST1 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse heart tissue,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDST1 encodes the bifunctional GlcNAc N-deacetylase\/N-sulfotransferase NDST1, which has an important function in the generation of sulfated ligandbinding sites during heparan sulfate biosynthesis. NDST1 is a type II transmembrane protein that resides in the Golgi apparatus and catalyzes both N-deacetylation and N-sulfation of N-acetylglucosamine (GlcNAc) units of the HS polysaccharide chain (PMID: 25125150). In mice, Ndst1 is crucial for embryonic development and homozygous null mutations are perinatally lethal (PMID: 16020517, 38129107).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24422 Product name: Recombinant human NDST1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 38-90 aa of BC012888 Sequence: LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVE Predict reactive species\nFull Name: N-deacetylase\/N-sulfotransferase (heparan glucosaminyl) 1\nCalculated Molecular Weight: 882 aa, 101 kDa\nObserved Molecular Weight: 68-70 kDa\nGenBank Accession Number: BC012888\nGene Symbol: NDST1\nGene ID (NCBI): 3340\nRRID: AB_2880423\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52848\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868943110313,"sku":"26203-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26203-1-ap","provider":"Iright","version":"1.0","type":"link"}