{"product_id":"proteintech-26226-1-ap","title":"Proteintech, 26226-1-AP, EDEM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EDEM1 (26226-1-AP) by Proteintech is a Polyclonal antibody targeting EDEM1 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n26226-1-AP targets EDEM1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells,  mouse liver,  rat liver\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24046 Product name: Recombinant human EDEM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 564-657 aa of BC019088 Sequence: EDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI Predict reactive species\nFull Name: ER degradation enhancer, mannosidase alpha-like 1\nCalculated Molecular Weight: 74 kDa\nObserved Molecular Weight: 66-75 kDa\nGenBank Accession Number: BC019088\nGene Symbol: EDEM1\nGene ID (NCBI): 9695\nRRID: AB_2880433\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92611\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868979712169,"sku":"26226-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26226-1-ap","provider":"Iright","version":"1.0","type":"link"}