{"product_id":"proteintech-26235-1-ap","title":"Proteintech, 26235-1-AP, FGF13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGF13 (26235-1-AP) by Proteintech is a Polyclonal antibody targeting FGF13 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26235-1-AP targets FGF13 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFGF13 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23965 Product name: Recombinant human FGF13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 212-245 aa of BC034340 Sequence: LTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST Predict reactive species\nFull Name: fibroblast growth factor 13\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC034340\nGene Symbol: FGF13\nGene ID (NCBI): 2258\nRRID: AB_2880438\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92913\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869683503273,"sku":"26235-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26235-1-ap","provider":"Iright","version":"1.0","type":"link"}