{"product_id":"proteintech-26237-1-ap","title":"Proteintech, 26237-1-AP, HAMP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HAMP (26237-1-AP) by Proteintech is a Polyclonal antibody targeting HAMP in WB, IP, ELISA applications with reactivity to human samples\n26237-1-AP targets HAMP in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IP detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHepcidin (HAMP) is a liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. It acts by promoting endocytosis and degradation of ferroportin\/SLC40A1, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma (PMID: 22682227; 29237594; 32814342). Hepcidin is an 84-amino acid prepropeptide, and is usually cleaved into three peptide types, hepcidin-20, hepcidin-22, and hepcidin-25, of which hepcidin-25 is the active form and plays important roles in regulating functional iron deficiency (PMID: 34262329).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24065 Product name: Recombinant human HAMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-84 aa of BC020612 Sequence: SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT Predict reactive species\nFull Name: hepcidin antimicrobial peptide\nCalculated Molecular Weight: 9 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC020612\nGene Symbol: HAMP\nGene ID (NCBI): 57817\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P81172\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887662780585,"sku":"26237-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26237-1-ap","provider":"Iright","version":"1.0","type":"link"}