{"product_id":"proteintech-26247-1-ap","title":"Proteintech, 26247-1-AP, GIT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GIT1 (26247-1-AP) by Proteintech is a Polyclonal antibody targeting GIT1 in WB, ELISA applications with reactivity to human, rat samples\n26247-1-AP targets GIT1 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: ROS1728 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGIT1 (ARF GTPase-activating protein GIT1) is a member of the GIT subfamily of ADP ribosylation factor (ARF)-GTPase activating protein (GAP) family of proteins, which are characterized by an ARFGAP domain that stimulates the GTPase activity of proteins. GIT1 was highly expressed in the nervous system, and its expression was maintained throughout all brain neuritogenesis stages (PMID: 27127481).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24648 Product name: Recombinant human GIT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 471-640 aa of BC067358 Sequence: LRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLP Predict reactive species\nFull Name: G protein-coupled receptor kinase interacting ArfGAP 1\nCalculated Molecular Weight: 694 aa, 77 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC067358\nGene Symbol: GIT1\nGene ID (NCBI): 28964\nRRID: AB_2880445\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2X7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869687468201,"sku":"26247-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26247-1-ap","provider":"Iright","version":"1.0","type":"link"}