{"product_id":"proteintech-26250-1-ap","title":"Proteintech, 26250-1-AP, TAOK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAOK1 (26250-1-AP) by Proteintech is a Polyclonal antibody targeting TAOK1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human,  mouse samples\n26250-1-AP targets TAOK1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  mouse testis tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThousand and one kinase 1 (TAOK1), also known as prostate-derived sterile 20 (Ste20)-like kinase 2, TAO1 (thousand and one amino-acid protein 1) or MARKK, is a member of the MAP3K protein kinase and belongs to the germinal-center kinase-like class of sterile 20 (Ste20)-like kinases (PMID: 29400705). TAOK1 is involved in mammalian brain development and functions as a negative regulator in IL-17-mediated signaling and inflammation (PMID: 33565190). TAOK1 has a calculated molecular mass of 116 kDa and encodes a serine\/threonine protein kinase at its N terminus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22461 Product name: Recombinant human TAOK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 890-1001 aa of BC133039 Sequence: MVLSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT Predict reactive species\nFull Name: TAO kinase 1\nCalculated Molecular Weight: 1001 aa, 116 kDa\nObserved Molecular Weight: 116 kDa\nGenBank Accession Number: BC133039\nGene Symbol: TAOK1\nGene ID (NCBI): 57551\nRRID: AB_2880446\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7L7X3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868945698985,"sku":"26250-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26250-1-ap","provider":"Iright","version":"1.0","type":"link"}