{"product_id":"proteintech-26305-1-ap","title":"Proteintech, 26305-1-AP, PDILT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDILT (26305-1-AP) by Proteintech is a Polyclonal antibody targeting PDILT in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n26305-1-AP targets PDILT in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDILT, a divergent testis-specific protein disulfide isomerase with a non-classical SXXC motif that engages in disulfide-dependent interactions in the endoplasmic reticulum (PMID: 15475357). PDILT interacts with CALR3 in the testicular germ cells and plays an indispensable role in the disulfide formation in the ADAM3. The PDILT knockout mice were male infertile, consistent with the previous observations that spermatozoa lacking ADAM3 cannot migrate through the UTJ and cannot bind to the ZP (PMID: 22357757). It can be detected as 67 kDa and 75kDa due to the glycosylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23675 Product name: Recombinant human PDILT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-584 aa of BC042607 Sequence: KLINDSTNKQELNRVIKQHLTDFVIEYNTENKDLISELHIMSHMLLFVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGRVFKYFRVTEVDIPSVQILNLSSDARYKMPSDDITYESLKKFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFVMFYAPWSKKCKMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGSQQAVLYKGEHTLKGFSDFLESHIKTKIEDEDELLSVEQNEVIEEEVLAEEKEVPMMRKGLPEQQSPELENMTKYVSKLEEPAGKKKTSEEVVVVVAKPKGPPVQKKKPKVKEEL Predict reactive species\nFull Name: protein disulfide isomerase-like, testis expressed\nObserved Molecular Weight: 67 kDa, 75 kDa\nGenBank Accession Number: BC042607\nGene Symbol: PDILT\nGene ID (NCBI): 204474\nRRID: AB_2880472\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N807\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887755579561,"sku":"26305-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26305-1-ap","provider":"Iright","version":"1.0","type":"link"}