{"product_id":"proteintech-26306-1-ap","title":"Proteintech, 26306-1-AP, RNF144B\/IBRDC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF144B\/IBRDC2 (26306-1-AP) by Proteintech is a Polyclonal antibody targeting RNF144B\/IBRDC2 in WB, IP, IHC, ELISA applications with reactivity to human samples\n26306-1-AP targets RNF144B\/IBRDC2 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23679 Product name: Recombinant human RNF144B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-187 aa of BC063311 Sequence: VADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAE Predict reactive species\nFull Name: ring finger protein 144B\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC063311\nGene Symbol: RNF144B\nGene ID (NCBI): 255488\nRRID: AB_2880473\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z419\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869756117161,"sku":"26306-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26306-1-ap","provider":"Iright","version":"1.0","type":"link"}