{"product_id":"proteintech-26324-1-ap","title":"Proteintech, 26324-1-AP, C10orf104 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C10orf104 (26324-1-AP) by Proteintech is a Polyclonal antibody targeting C10orf104 in IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n26324-1-AP targets C10orf104 in IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC10orf104 (also known as ANAPC16 or APC16) is a protein associated with the anaphase-promoting complex\/cyclosome (APC\/C). APC\/C is a highly conserved E3 ubiquitin ligase that regulates various stages of the cell cycle, particularly the transition from mitotic to non-mitotic phases and the entry into the G1 phase during mitosis. As a subunit of APC\/C, C10orf104 contributes to its stability and modulates its ubiquitin ligase activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23641 Product name: Recombinant human C10orf104 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC009530 Sequence: MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG Predict reactive species\nFull Name: chromosome 10 open reading frame 104\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC009530\nGene Symbol: C10orf104\nGene ID (NCBI): 119504\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96DE5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885348049065,"sku":"26324-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26324-1-ap","provider":"Iright","version":"1.0","type":"link"}