{"product_id":"proteintech-26399-1-ap","title":"Proteintech, 26399-1-AP, SLCO4A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLCO4A1 (26399-1-AP) by Proteintech is a Polyclonal antibody targeting SLCO4A1 in WB, ELISA applications with reactivity to human samples\n26399-1-AP targets SLCO4A1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLCO4A (Solute carrier organic anion transporter family member 4A1), also referred to as OATP4A1, is a membrane transporter protein, primarily facilitates the transmembrane transport of substances that are independent of Na+, including lipid‑soluble drugs, thyroid and adrenal hormones, and a selected few toxin (PMID: 38275113). SLCO4A1 is highly expressed in several cancers and promotes cell proliferation, migration and invasion (PMID: 28378090). Besides, SLCO4A1 was highly expressed in pancreatic cancer and could be a potential biomarker to target anticancer drugs to pancreatic carcinoma (PMID: 34924768).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23905 Product name: Recombinant human SLCO4A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC015727 Sequence: MPLHQLGDKPLTFPSPNSAMENGLDHTPPSRRASPGTPLSPGSLRSAAHSPLDTSKQPLCQLWAEKHGARGTHEVRYISAGQSVACGWWAFAPPCLQVLNTPK Predict reactive species\nFull Name: solute carrier organic anion transporter family, member 4A1\nCalculated Molecular Weight: 77 kDa\nObserved Molecular Weight: 77 kDa\nGenBank Accession Number: BC015727\nGene Symbol: SLCO4A1\nGene ID (NCBI): 28231\nRRID: AB_2880501\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96BD0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869767061673,"sku":"26399-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-26399-1-ap","provider":"Iright","version":"1.0","type":"link"}